Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Hypothetical protein PF0725 [141938] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [141939] (1 PDB entry) Uniprot Q8U2V3 6-121 |
Domain d1y81a1: 1y81 A:6-121 [122731] complexed with coa, scn, unx |
PDB Entry: 1y81 (more details), 1.7 Å
SCOPe Domain Sequences for d1y81a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} frkialvgasknpakygniilkdllskgfevlpvnpnydeieglkcyrsvrelpkdvdvi vfvvppkvglqvakeaveagfkklwfqpgaeseeirrflekagveysfgrcimvet
Timeline for d1y81a1: