Lineage for d1y7ub1 (1y7u B:8-171)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721378Family d.38.1.1: 4HBT-like [54638] (16 proteins)
    Pfam PF03061
  6. 721385Protein Acyl-coa hydrolase BC2038 [143164] (1 species)
  7. 721386Species Bacillus cereus [TaxId:1396] [143165] (1 PDB entry)
  8. 721388Domain d1y7ub1: 1y7u B:8-171 [122723]
    automatically matched to 1Y7U A:8-171
    complexed with ca, coa, so4

Details for d1y7ub1

PDB Entry: 1y7u (more details), 2.8 Å

PDB Description: Crystal Structure of Acyl-Coa hydrolase from Bacillus cereus
PDB Compounds: (B:) acyl-CoA hydrolase

SCOP Domain Sequences for d1y7ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ub1 d.38.1.1 (B:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]}
kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv
dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn
pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf

SCOP Domain Coordinates for d1y7ub1:

Click to download the PDB-style file with coordinates for d1y7ub1.
(The format of our PDB-style files is described here.)

Timeline for d1y7ub1: