Lineage for d1y7ub_ (1y7u B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944340Species Bacillus cereus [TaxId:1396] [186868] (1 PDB entry)
  8. 2944341Domain d1y7ub_: 1y7u B: [122723]
    Other proteins in same PDB: d1y7ua1
    automated match to d1vpma_
    complexed with ca, coa, so4

Details for d1y7ub_

PDB Entry: 1y7u (more details), 2.8 Å

PDB Description: Crystal Structure of Acyl-Coa hydrolase from Bacillus cereus
PDB Compounds: (B:) acyl-CoA hydrolase

SCOPe Domain Sequences for d1y7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ub_ d.38.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv
dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn
pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf

SCOPe Domain Coordinates for d1y7ub_:

Click to download the PDB-style file with coordinates for d1y7ub_.
(The format of our PDB-style files is described here.)

Timeline for d1y7ub_: