![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:1396] [186868] (1 PDB entry) |
![]() | Domain d1y7ub_: 1y7u B: [122723] Other proteins in same PDB: d1y7ua1 automated match to d1vpma_ complexed with ca, coa, so4 |
PDB Entry: 1y7u (more details), 2.8 Å
SCOPe Domain Sequences for d1y7ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7ub_ d.38.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]} kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
Timeline for d1y7ub_: