SCOP 1.75: Domain d1y7tb2: 1y7t B:154-332

Lineage for d1y7tb2 (1y7t B:154-332)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Thermus thermophilus [TaxId:274] [82806] (5 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1y7tb2: 1y7t B:154-332 [122721]
   Other proteins in same PDB: d1y7ta1, d1y7tb1
   automatically matched to d1iz9a2
   complexed with ndp, trs

Details for d1y7tb2

PDB Entry: 1y7t, 1.65 Å

PDB Description: Crystal structure of NAD(H)-depenent malate dehydrogenase complexed with NADPH

PDB Compounds: (B:) malate dehydrogenase

SCOP Domain Sequences for d1y7tb2:

Sequence; same for both SEQRES and ATOM records:

>d1y7tb2 d.162.1.1 (B:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

Timeline for d1y7tb2:

• d1y7tb2 first appeared in SCOP 1.73
  
• d1y7tb2 appears in SCOPe 2.01
  
• d1y7tb2 appears in the current release, SCOPe 2.08