Lineage for d1y7ta2 (1y7t A:154-332)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737029Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 737030Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 737031Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 737139Protein Malate dehydrogenase [56329] (11 species)
  7. 737232Species Thermus thermophilus [TaxId:274] [82806] (5 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 737235Domain d1y7ta2: 1y7t A:154-332 [122719]
    Other proteins in same PDB: d1y7ta1, d1y7tb1
    automatically matched to d1iz9a2
    complexed with ndp, trs

Details for d1y7ta2

PDB Entry: 1y7t (more details), 1.65 Å

PDB Description: Crystal structure of NAD(H)-depenent malate dehydrogenase complexed with NADPH
PDB Compounds: (A:) malate dehydrogenase

SCOP Domain Sequences for d1y7ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1y7ta2:

Click to download the PDB-style file with coordinates for d1y7ta2.
(The format of our PDB-style files is described here.)

Timeline for d1y7ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y7ta1