Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Malate dehydrogenase [51849] (12 species) |
Species Thermus thermophilus [TaxId:274] [82300] (5 PDB entries) identical sequence to that from the Thermus flavus enzyme |
Domain d1y7ta1: 1y7t A:0-153 [122718] Other proteins in same PDB: d1y7ta2, d1y7tb2 automatically matched to d1iz9a1 complexed with ndp, trs |
PDB Entry: 1y7t (more details), 1.65 Å
SCOP Domain Sequences for d1y7ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva kkdvkvlvvgnpantnaliayknapglnprnfta
Timeline for d1y7ta1: