SCOPe 2.07: Domain d1y7rb_: 1y7r B:

Lineage for d1y7rb_ (1y7r B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein SA2161 [143674] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [143675] (1 PDB entry)
   Uniprot Q7A3W2 1-133

8. Domain d1y7rb_: 1y7r B: [122717]
   automated match to d1y7ra1
   complexed with po4

Details for d1y7rb_

PDB Entry: 1y7r, 1.7 Å

PDB Description: 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase

PDB Compounds: (B:) hypothetical protein SA2161

SCOPe Domain Sequences for d1y7rb_:

Sequence; same for both SEQRES and ATOM records:

>d1y7rb_ d.108.1.1 (B:) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}
mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
ptepdsggmyiky

Timeline for d1y7rb_:

• d1y7rb_ first appeared in SCOP 1.73, called d1y7rb1
  
• d1y7rb_ appears in SCOPe 2.06
  
• d1y7rb_ appears in the current release, SCOPe 2.08