Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins) |
Protein Hypothetical protein SA2161 [143674] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [143675] (1 PDB entry) Uniprot Q7A3W2 1-133 |
Domain d1y7rb1: 1y7r B:1-133 [122717] automatically matched to 1Y7R A:1-133 complexed with po4; mutant |
PDB Entry: 1y7r (more details), 1.7 Å
SCOP Domain Sequences for d1y7rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7rb1 d.108.1.1 (B:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm ptepdsggmyiky
Timeline for d1y7rb1: