Lineage for d1y7rb1 (1y7r B:1-133)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731148Protein Hypothetical protein SA2161 [143674] (1 species)
  7. 731149Species Staphylococcus aureus [TaxId:1280] [143675] (1 PDB entry)
  8. 731151Domain d1y7rb1: 1y7r B:1-133 [122717]
    automatically matched to 1Y7R A:1-133
    complexed with po4; mutant

Details for d1y7rb1

PDB Entry: 1y7r (more details), 1.7 Å

PDB Description: 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase
PDB Compounds: (B:) hypothetical protein SA2161

SCOP Domain Sequences for d1y7rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7rb1 d.108.1.1 (B:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}
mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
ptepdsggmyiky

SCOP Domain Coordinates for d1y7rb1:

Click to download the PDB-style file with coordinates for d1y7rb1.
(The format of our PDB-style files is described here.)

Timeline for d1y7rb1: