SCOPe 2.06: Domain d1y7ra1: 1y7r A:1-133

Lineage for d1y7ra1 (1y7r A:1-133)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein SA2161 [143674] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [143675] (1 PDB entry)
   Uniprot Q7A3W2 1-133

8. Domain d1y7ra1: 1y7r A:1-133 [122716]
   complexed with po4

Details for d1y7ra1

PDB Entry: 1y7r, 1.7 Å

PDB Description: 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase

PDB Compounds: (A:) hypothetical protein SA2161

SCOPe Domain Sequences for d1y7ra1:

Sequence; same for both SEQRES and ATOM records:

>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}
mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
ptepdsggmyiky

Timeline for d1y7ra1:

• d1y7ra1 first appeared in SCOP 1.73
  
• d1y7ra1 appears in SCOPe 2.05
  
• d1y7ra1 appears in SCOPe 2.07
  
• d1y7ra1 appears in the current release, SCOPe 2.08