Lineage for d1y7qb1 (1y7q B:37-132)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767347Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 767453Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families) (S)
  5. 767476Family a.28.3.2: SCAN domain [140466] (2 proteins)
    Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain
  6. 767477Protein Zinc finger protein 174 [140469] (1 species)
  7. 767478Species Human (Homo sapiens) [TaxId:9606] [140470] (1 PDB entry)
    Uniprot Q15697 37-132
  8. 767480Domain d1y7qb1: 1y7q B:37-132 [122715]
    automatically matched to 1Y7Q A:37-132
    mutant

Details for d1y7qb1

PDB Entry: 1y7q (more details)

PDB Description: mammalian scan domain dimer is a domain-swapped homologue of the hiv capsid c-terminal domain
PDB Compounds: (B:) Zinc finger protein 174

SCOP Domain Sequences for d1y7qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7qb1 a.28.3.2 (B:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]}
kncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqflt
ilpeeiqarvrhrclmsskeivtlvedfhraskkpk

SCOP Domain Coordinates for d1y7qb1:

Click to download the PDB-style file with coordinates for d1y7qb1.
(The format of our PDB-style files is described here.)

Timeline for d1y7qb1: