SCOP 1.75: Domain d1y7qb1: 1y7q B:37-132

Lineage for d1y7qb1 (1y7q B:37-132)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families)

5. Family a.28.3.2: SCAN domain [140466] (2 proteins)
   Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain

6. Protein Zinc finger protein 174 [140469] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140470] (1 PDB entry)
   Uniprot Q15697 37-132

8. Domain d1y7qb1: 1y7q B:37-132 [122715]
   automatically matched to 1Y7Q A:37-132
   mutant

Details for d1y7qb1

PDB Entry: 1y7q

PDB Description: mammalian scan domain dimer is a domain-swapped homologue of the hiv capsid c-terminal domain

PDB Compounds: (B:) Zinc finger protein 174

SCOP Domain Sequences for d1y7qb1:

Sequence; same for both SEQRES and ATOM records:

>d1y7qb1 a.28.3.2 (B:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]}
kncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqflt
ilpeeiqarvrhrclmsskeivtlvedfhraskkpk

Timeline for d1y7qb1:

• d1y7qb1 first appeared in SCOP 1.73
  
• d1y7qb1 appears in SCOPe 2.01
  
• d1y7qb1 appears in the current release, SCOPe 2.08, called d1y7qb2