Lineage for d1y7qb2 (1y7q B:37-132)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1992228Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1992293Family a.28.3.2: SCAN domain [140466] (2 protein domains)
    Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain
  6. 1992294Protein Zinc finger protein 174 [140469] (1 species)
  7. 1992295Species Human (Homo sapiens) [TaxId:9606] [140470] (1 PDB entry)
    Uniprot Q15697 37-132
  8. 1992297Domain d1y7qb2: 1y7q B:37-132 [122715]
    Other proteins in same PDB: d1y7qa2, d1y7qb3
    automated match to d1y7qa1

Details for d1y7qb2

PDB Entry: 1y7q (more details)

PDB Description: Mammalian SCAN domain dimer is a domain-swapped homologue of the HIV capsid C-terminal domain
PDB Compounds: (B:) Zinc finger protein 174

SCOPe Domain Sequences for d1y7qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7qb2 a.28.3.2 (B:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]}
kncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqflt
ilpeeiqarvrhrclmsskeivtlvedfhraskkpk

SCOPe Domain Coordinates for d1y7qb2:

Click to download the PDB-style file with coordinates for d1y7qb2.
(The format of our PDB-style files is described here.)

Timeline for d1y7qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y7qb3