SCOPe 2.08: Domain d1y7qa1: 1y7q A:37-132

Lineage for d1y7qa1 (1y7q A:37-132)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.2: SCAN domain [140466] (2 proteins)
   Pfam PF02023; forms segment-swapped dimers compared to the retroviral capsid domain

6. Protein Zinc finger protein 174 [140469] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140470] (1 PDB entry)
   Uniprot Q15697 37-132

8. Domain d1y7qa1: 1y7q A:37-132 [122714]
   Other proteins in same PDB: d1y7qa2, d1y7qb3

Details for d1y7qa1

PDB Entry: 1y7q

PDB Description: mammalian scan domain dimer is a domain-swapped homologue of the hiv capsid c-terminal domain

PDB Compounds: (A:) Zinc finger protein 174

SCOPe Domain Sequences for d1y7qa1:

Sequence; same for both SEQRES and ATOM records:

>d1y7qa1 a.28.3.2 (A:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]}
kncpdpelcrqsfrrfcyqevsgpqealsqlrqlcrqwlqpelhtkeqilellvmeqflt
ilpeeiqarvrhrclmsskeivtlvedfhraskkpk

Timeline for d1y7qa1:

• d1y7qa1 first appeared in SCOP 1.73
  
• d1y7qa1 appears in SCOPe 2.07