SCOP 1.73: Domain d1y7pc2: 1y7p C:5-78

Lineage for d1y7pc2 (1y7p C:5-78)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.12: AF1403 N-terminal domain-like [143398] (1 protein)
   dimerizes with the formation of a single intersubunit beta-sheet

6. Protein Hypothetical protein AF1403, N-terminal domain [143399] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143400] (1 PDB entry)

8. Domain d1y7pc2: 1y7p C:5-78 [122713]
   Other proteins in same PDB: d1y7pa1, d1y7pb1, d1y7pc1
   automatically matched to 1Y7P A:2-78
   complexed with rip, zn

Details for d1y7pc2

PDB Entry: 1y7p, 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator

PDB Compounds: (C:) Hypothetical protein AF1403

SCOP Domain Sequences for d1y7pc2:

Sequence, based on SEQRES records:

>d1y7pc2 d.58.18.12 (C:5-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
lriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdfekiler
vktfdyiieieeee

Sequence, based on observed residues (ATOM records):

>d1y7pc2 d.58.18.12 (C:5-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
lriiaenkigvlrdlttiiaeeitfaqtflikhgehegkaliyfeilervktfdyiieie
eee

Timeline for d1y7pc2:

• d1y7pc2 is new in SCOP 1.73
  
• d1y7pc2 appears in SCOP 1.75
  
• d1y7pc2 appears in the current release, SCOPe 2.08