Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.12: AF1403 N-terminal domain-like [143398] (1 protein) dimerizes with the formation of a single intersubunit beta-sheet automatically mapped to Pfam PF01842 |
Protein Hypothetical protein AF1403, N-terminal domain [143399] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [143400] (1 PDB entry) Uniprot O28869 2-78 |
Domain d1y7pb2: 1y7p B:1-78 [122711] Other proteins in same PDB: d1y7pa1, d1y7pb1, d1y7pb3, d1y7pc1, d1y7pc3 automated match to d1y7pa2 complexed with rip, zn |
PDB Entry: 1y7p (more details), 1.9 Å
SCOPe Domain Sequences for d1y7pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7pb2 d.58.18.12 (B:1-78) Hypothetical protein AF1403, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} mlrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdfek ilervktfdyiieieeee
Timeline for d1y7pb2: