Lineage for d1y7pb2 (1y7p B:2-78)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863190Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 863351Family d.58.18.12: AF1403 N-terminal domain-like [143398] (1 protein)
    dimerizes with the formation of a single intersubunit beta-sheet
  6. 863352Protein Hypothetical protein AF1403, N-terminal domain [143399] (1 species)
  7. 863353Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143400] (1 PDB entry)
    Uniprot O28869 2-78
  8. 863355Domain d1y7pb2: 1y7p B:2-78 [122711]
    Other proteins in same PDB: d1y7pa1, d1y7pb1, d1y7pc1
    automatically matched to 1Y7P A:2-78
    complexed with rip, zn

Details for d1y7pb2

PDB Entry: 1y7p (more details), 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator
PDB Compounds: (B:) Hypothetical protein AF1403

SCOP Domain Sequences for d1y7pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7pb2 d.58.18.12 (B:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
lrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdfeki
lervktfdyiieieeee

SCOP Domain Coordinates for d1y7pb2:

Click to download the PDB-style file with coordinates for d1y7pb2.
(The format of our PDB-style files is described here.)

Timeline for d1y7pb2: