Lineage for d1y7pb1 (1y7p B:79-215)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464076Family c.23.1.7: AF1403 C-terminal domain-like [142040] (1 protein)
  6. 2464077Protein Hypothetical protein AF1403, C-terminal domain [142041] (1 species)
  7. 2464078Species Archaeoglobus fulgidus [TaxId:2234] [142042] (1 PDB entry)
    Uniprot O28869 79-217
  8. 2464080Domain d1y7pb1: 1y7p B:79-215 [122710]
    Other proteins in same PDB: d1y7pa2, d1y7pb2, d1y7pb3, d1y7pc2, d1y7pc3
    automated match to d1y7pa1
    complexed with rip, zn

Details for d1y7pb1

PDB Entry: 1y7p (more details), 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator
PDB Compounds: (B:) Hypothetical protein AF1403

SCOPe Domain Sequences for d1y7pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7pb1 c.23.1.7 (B:79-215) Hypothetical protein AF1403, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
sfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav
srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtl
avmhisekakfdldrvk

SCOPe Domain Coordinates for d1y7pb1:

Click to download the PDB-style file with coordinates for d1y7pb1.
(The format of our PDB-style files is described here.)

Timeline for d1y7pb1: