SCOP 1.73: Domain d1y7pb1: 1y7p B:79-215

Lineage for d1y7pb1 (1y7p B:79-215)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.7: AF1403 C-terminal domain-like [142040] (1 protein)

6. Protein Hypothetical protein AF1403, C-terminal domain [142041] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [142042] (1 PDB entry)

8. Domain d1y7pb1: 1y7p B:79-215 [122710]
   Other proteins in same PDB: d1y7pa2, d1y7pb2, d1y7pc2
   automatically matched to 1Y7P A:79-217
   complexed with rip, zn

Details for d1y7pb1

PDB Entry: 1y7p, 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator

PDB Compounds: (B:) Hypothetical protein AF1403

SCOP Domain Sequences for d1y7pb1:

Sequence; same for both SEQRES and ATOM records:

>d1y7pb1 c.23.1.7 (B:79-215) Hypothetical protein AF1403, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
sfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav
srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtl
avmhisekakfdldrvk

Timeline for d1y7pb1:

• d1y7pb1 is new in SCOP 1.73
  
• d1y7pb1 appears in SCOP 1.75
  
• d1y7pb1 appears in the current release, SCOPe 2.08