Lineage for d1y7pa1 (1y7p A:79-217)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838064Family c.23.1.7: AF1403 C-terminal domain-like [142040] (1 protein)
  6. 1838065Protein Hypothetical protein AF1403, C-terminal domain [142041] (1 species)
  7. 1838066Species Archaeoglobus fulgidus [TaxId:2234] [142042] (1 PDB entry)
    Uniprot O28869 79-217
  8. 1838067Domain d1y7pa1: 1y7p A:79-217 [122708]
    Other proteins in same PDB: d1y7pa2, d1y7pb2, d1y7pc2
    complexed with rip, zn

Details for d1y7pa1

PDB Entry: 1y7p (more details), 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator
PDB Compounds: (A:) Hypothetical protein AF1403

SCOPe Domain Sequences for d1y7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7pa1 c.23.1.7 (A:79-217) Hypothetical protein AF1403, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
sfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav
srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtl
avmhisekakfdldrvkgr

SCOPe Domain Coordinates for d1y7pa1:

Click to download the PDB-style file with coordinates for d1y7pa1.
(The format of our PDB-style files is described here.)

Timeline for d1y7pa1: