![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (7 families) ![]() |
![]() | Family c.23.1.7: AF1403 C-terminal domain-like [142040] (1 protein) |
![]() | Protein Hypothetical protein AF1403, C-terminal domain [142041] (1 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [142042] (1 PDB entry) Uniprot O28869 79-217 |
![]() | Domain d1y7pa1: 1y7p A:79-217 [122708] Other proteins in same PDB: d1y7pa2, d1y7pb2, d1y7pc2 complexed with rip, zn |
PDB Entry: 1y7p (more details), 1.9 Å
SCOP Domain Sequences for d1y7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7pa1 c.23.1.7 (A:79-217) Hypothetical protein AF1403, C-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} sfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtl avmhisekakfdldrvkgr
Timeline for d1y7pa1:
![]() Domains from other chains: (mouse over for more information) d1y7pb1, d1y7pb2, d1y7pc1, d1y7pc2 |