Lineage for d1y7of_ (1y7o F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460579Protein Clp protease, ClpP subunit [52098] (10 species)
  7. 2460721Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141998] (1 PDB entry)
    Uniprot P63788 2-193
  8. 2460727Domain d1y7of_: 1y7o F: [122706]
    automated match to d1y7oa1
    complexed with ca

Details for d1y7of_

PDB Entry: 1y7o (more details), 2.51 Å

PDB Description: the structure of streptococcus pneumoniae a153p clpp
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d1y7of_:

Sequence, based on SEQRES records: (download)

>d1y7of_ c.14.1.1 (F:) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mipvvieqtsrgersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiyl
yvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymi
hqpmggtgggtqqtdmaiapehllktrntlekilaensgqsmekvhadaerdnwmsaqet
leygfideimannsl

Sequence, based on observed residues (ATOM records): (download)

>d1y7of_ c.14.1.1 (F:) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mipvvisydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntpggs
vsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpmapeh
llktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimannsl

SCOPe Domain Coordinates for d1y7of_:

Click to download the PDB-style file with coordinates for d1y7of_.
(The format of our PDB-style files is described here.)

Timeline for d1y7of_: