Lineage for d1y7of1 (1y7o F:2-193)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824390Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 824391Protein Clp protease, ClpP subunit [52098] (5 species)
  7. 824499Species Streptococcus pneumoniae [TaxId:1313] [141998] (1 PDB entry)
    Uniprot P63788 2-193
  8. 824505Domain d1y7of1: 1y7o F:2-193 [122706]
    automatically matched to 1Y7O A:2-193
    complexed with ca; mutant

Details for d1y7of1

PDB Entry: 1y7o (more details), 2.51 Å

PDB Description: the structure of streptococcus pneumoniae a153p clpp
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOP Domain Sequences for d1y7of1:

Sequence, based on SEQRES records: (download)

>d1y7of1 c.14.1.1 (F:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]}
ipvvieqtsrgersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiyly
vntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymih
qpmggtgggtqqtdmaiapehllktrntlekilaensgqsmekvhadaerdnwmsaqetl
eygfideimann

Sequence, based on observed residues (ATOM records): (download)

>d1y7of1 c.14.1.1 (F:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]}
ipvvisydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntpggsv
saglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpmapehl
lktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimann

SCOP Domain Coordinates for d1y7of1:

Click to download the PDB-style file with coordinates for d1y7of1.
(The format of our PDB-style files is described here.)

Timeline for d1y7of1: