Lineage for d1y7oc_ (1y7o C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852507Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141998] (1 PDB entry)
    Uniprot P63788 2-193
  8. 2852510Domain d1y7oc_: 1y7o C: [122703]
    automated match to d1y7oa1
    complexed with ca

Details for d1y7oc_

PDB Entry: 1y7o (more details), 2.51 Å

PDB Description: the structure of streptococcus pneumoniae a153p clpp
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d1y7oc_:

Sequence, based on SEQRES records: (download)

>d1y7oc_ c.14.1.1 (C:) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mipvvieqtsrgersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiyl
yvntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymi
hqpmggtgggtqqtdmaiapehllktrntlekilaensgqsmekvhadaerdnwmsaqet
leygfideimannsl

Sequence, based on observed residues (ATOM records): (download)

>d1y7oc_ c.14.1.1 (C:) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mipvvieqrsydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntp
ggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpma
pehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimannsl

SCOPe Domain Coordinates for d1y7oc_:

Click to download the PDB-style file with coordinates for d1y7oc_.
(The format of our PDB-style files is described here.)

Timeline for d1y7oc_: