Lineage for d1y7na1 (1y7n A:12-90)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666584Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 666585Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    structure of the PTB domain is also known (scop_sp 50757)
  8. 666586Domain d1y7na1: 1y7n A:12-90 [122700]
    2nd PDZ domain

Details for d1y7na1

PDB Entry: 1y7n (more details)

PDB Description: solution structure of the second pdz domain of the human neuronal adaptor x11alpha
PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family A member 1

SCOP Domain Sequences for d1y7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
vttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieingqsvvatpheki
vhilsnavgeihmktmpaa

SCOP Domain Coordinates for d1y7na1:

Click to download the PDB-style file with coordinates for d1y7na1.
(The format of our PDB-style files is described here.)

Timeline for d1y7na1: