Lineage for d1y7na1 (1y7n A:12-90)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048302Protein Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) [141282] (1 species)
  7. 2048303Species Human (Homo sapiens) [TaxId:9606] [141283] (6 PDB entries)
    Uniprot Q02410 656-740! Uniprot Q02410 657-743! Uniprot Q02410 657-745! Uniprot Q02410 743-822! Uniprot Q02410 745-823! Uniprot Q02410 746-839
    structure of the PTB domain is also known (50757)
  8. 2048304Domain d1y7na1: 1y7n A:12-90 [122700]
    Other proteins in same PDB: d1y7na2
    2nd PDZ domain

Details for d1y7na1

PDB Entry: 1y7n (more details)

PDB Description: Solution structure of the second PDZ domain of the human neuronal adaptor X11alpha
PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family A member 1

SCOPe Domain Sequences for d1y7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]}
vttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieingqsvvatpheki
vhilsnavgeihmktmpaa

SCOPe Domain Coordinates for d1y7na1:

Click to download the PDB-style file with coordinates for d1y7na1.
(The format of our PDB-style files is described here.)

Timeline for d1y7na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y7na2