![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily) barrel, closed; n=8, S=10; one overside connection |
![]() | Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) ![]() automatically mapped to Pfam PF03734 |
![]() | Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins) Pfam PF03734; ErfK/YbiS/YcfS/YnhG |
![]() | Protein Hypothetical protein YkuD, C-terminal domain [141527] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141528] (1 PDB entry) Uniprot O34816 49-164 |
![]() | Domain d1y7ma1: 1y7m A:49-164 [122696] Other proteins in same PDB: d1y7ma2, d1y7mb2 complexed with cd, so4 |
PDB Entry: 1y7m (more details), 2.05 Å
SCOPe Domain Sequences for d1y7ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7ma1 b.160.1.1 (A:49-164) Hypothetical protein YkuD, C-terminal domain {Bacillus subtilis [TaxId: 1423]} pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf gaywlslsaahygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr
Timeline for d1y7ma1: