Lineage for d1y7la1 (1y7l A:2-311)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2514910Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2514937Species Haemophilus influenzae [TaxId:727] [142746] (3 PDB entries)
    Uniprot P45040 2-311
  8. 2514938Domain d1y7la1: 1y7l A:2-311 [122695]
    complexed with so4

Details for d1y7la1

PDB Entry: 1y7l (more details), 1.55 Å

PDB Description: O-Acetylserine Sulfhydrylase Complex
PDB Compounds: (A:) O-acetylserine sulfhydrylase

SCOPe Domain Sequences for d1y7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalf

SCOPe Domain Coordinates for d1y7la1:

Click to download the PDB-style file with coordinates for d1y7la1.
(The format of our PDB-style files is described here.)

Timeline for d1y7la1: