Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein) |
Protein Beta-D-xylosidase C-terminal domain [141162] (4 species) |
Species Clostridium acetobutylicum [TaxId:1488] [141164] (2 PDB entries) Uniprot Q97DM1 323-532 |
Domain d1y7bc1: 1y7b C:325-534 [122691] Other proteins in same PDB: d1y7ba2, d1y7ba3, d1y7ba4, d1y7bb2, d1y7bb3, d1y7bb4, d1y7bc2, d1y7bc3, d1y7bc4, d1y7bd2, d1y7bd3, d1y7bd4 automated match to d1y7ba1 complexed with ca, epe, gol, pge, so4 |
PDB Entry: 1y7b (more details), 1.6 Å
SCOPe Domain Sequences for d1y7bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7bc1 b.29.1.23 (C:325-534) Beta-D-xylosidase C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} ektydekdnfdsdklninfqslriplteniaslkakkgnlrlygkesltstftqafiarr wqsfkfdastsvsfspdtfqqaagltcyyntenwstiqvtwnedkgrvidivccdnfhfd mplksnvipipkdveyihlkvevrvetyqysysfdginwskvpaifesrklsddyvqggg fftgafvginciditgnnkpadfdyfcyke
Timeline for d1y7bc1: