Class b: All beta proteins [48724] (174 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) |
Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) |
Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
Species Clostridium acetobutylicum [TaxId:1488] [141542] (2 PDB entries) Uniprot Q97DM1 2-322 |
Domain d1y7bb2: 1y7b B:4-324 [122690] Other proteins in same PDB: d1y7ba1, d1y7bb1, d1y7bc1, d1y7bd1 automatically matched to 1Y7B A:4-324 complexed with ca, epe, gol, pge, so4 |
PDB Entry: 1y7b (more details), 1.6 Å
SCOPe Domain Sequences for d1y7bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7bb2 b.67.2.1 (B:4-324) Beta-D-xylosidase N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} iknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtslld mkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpitln gsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgtdi kytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdprns lqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnwpr vvggkqgsvnveapkipevkw
Timeline for d1y7bb2: