Lineage for d1y7ba1 (1y7b A:325-534)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780556Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 2780557Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 2780566Species Clostridium acetobutylicum [TaxId:1488] [141164] (2 PDB entries)
    Uniprot Q97DM1 323-532
  8. 2780567Domain d1y7ba1: 1y7b A:325-534 [122687]
    Other proteins in same PDB: d1y7ba2, d1y7ba3, d1y7ba4, d1y7bb2, d1y7bb3, d1y7bb4, d1y7bc2, d1y7bc3, d1y7bc4, d1y7bd2, d1y7bd3, d1y7bd4
    complexed with ca, epe, gol, pge, so4

Details for d1y7ba1

PDB Entry: 1y7b (more details), 1.6 Å

PDB Description: beta-d-xylosidase, a family 43 glycoside hydrolase
PDB Compounds: (A:) Beta-xylosidase, family 43 glycosyl hydrolase

SCOPe Domain Sequences for d1y7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ba1 b.29.1.23 (A:325-534) Beta-D-xylosidase C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
ektydekdnfdsdklninfqslriplteniaslkakkgnlrlygkesltstftqafiarr
wqsfkfdastsvsfspdtfqqaagltcyyntenwstiqvtwnedkgrvidivccdnfhfd
mplksnvipipkdveyihlkvevrvetyqysysfdginwskvpaifesrklsddyvqggg
fftgafvginciditgnnkpadfdyfcyke

SCOPe Domain Coordinates for d1y7ba1:

Click to download the PDB-style file with coordinates for d1y7ba1.
(The format of our PDB-style files is described here.)

Timeline for d1y7ba1: