Lineage for d1y76d_ (1y76 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018595Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2018596Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2018597Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. 2018611Protein Maguk p55 subfamily member 5, Patj [101292] (2 species)
  7. 2018612Species Human (Homo sapiens) [TaxId:9606] [140707] (1 PDB entry)
    Uniprot Q8N3R9 118-177
  8. 2018614Domain d1y76d_: 1y76 D: [122686]
    Other proteins in same PDB: d1y76a1, d1y76c_
    automated match to d1y76b1

Details for d1y76d_

PDB Entry: 1y76 (more details)

PDB Description: solution structure of patj/pals1 l27 domain complex
PDB Compounds: (D:) MAGUK p55 subfamily member 5

SCOPe Domain Sequences for d1y76d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y76d_ a.194.1.1 (D:) Maguk p55 subfamily member 5, Patj {Human (Homo sapiens) [TaxId: 9606]}
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas

SCOPe Domain Coordinates for d1y76d_:

Click to download the PDB-style file with coordinates for d1y76d_.
(The format of our PDB-style files is described here.)

Timeline for d1y76d_: