SCOP 1.73: Domain d1y76c1: 1y76 C:4-65

Lineage for d1y76c1 (1y76 C:4-65)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.194: L27 domain [101287] (1 superfamily)
   6 helices, heterodimer of 3-helical domains

4. Superfamily a.194.1: L27 domain [101288] (1 family)

5. Family a.194.1.1: L27 domain [101289] (5 proteins)

6. Protein Associated tight junction protein Pals-1 [101290] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [140706] (1 PDB entry)
   identical sequence to mouse domain

8. Domain d1y76c1: 1y76 C:4-65 [122685]
   Other proteins in same PDB: d1y76b1, d1y76d1
   automatically matched to 1Y76 A:4-65

Details for d1y76c1

PDB Entry: 1y76

PDB Description: solution structure of patj/pals1 l27 domain complex

PDB Compounds: (C:) protein associated to tight junctions

SCOP Domain Sequences for d1y76c1:

Sequence; same for both SEQRES and ATOM records:

>d1y76c1 a.194.1.1 (C:4-65) Associated tight junction protein Pals-1 {Rat (Rattus norvegicus) [TaxId: 10116]}
npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
ls

Timeline for d1y76c1:

• d1y76c1 is new in SCOP 1.73
  
• d1y76c1 appears in SCOP 1.75
  
• d1y76c1 appears in the current release, SCOPe 2.08, called d1y76c_