SCOPe 2.08: Domain d1y76b1: 1y76 B:80-139

Lineage for d1y76b1 (1y76 B:80-139)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.194: L27 domain [101287] (1 superfamily)
   6 helices, heterodimer of 3-helical domains

4. Superfamily a.194.1: L27 domain [101288] (1 family)

5. Family a.194.1.1: L27 domain [101289] (6 proteins)

6. Protein Maguk p55 subfamily member 5, Patj [101292] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140707] (1 PDB entry)
   Uniprot Q8N3R9 118-177

8. Domain d1y76b1: 1y76 B:80-139 [122684]
   Other proteins in same PDB: d1y76a1, d1y76c_

Details for d1y76b1

PDB Entry: 1y76

PDB Description: solution structure of patj/pals1 l27 domain complex

PDB Compounds: (B:) MAGUK p55 subfamily member 5

SCOPe Domain Sequences for d1y76b1:

Sequence; same for both SEQRES and ATOM records:

>d1y76b1 a.194.1.1 (B:80-139) Maguk p55 subfamily member 5, Patj {Human (Homo sapiens) [TaxId: 9606]}
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas

Timeline for d1y76b1:

• d1y76b1 first appeared in SCOP 1.73
  
• d1y76b1 appears in SCOPe 2.07