Lineage for d1y76b1 (1y76 B:80-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014536Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2014537Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2014538Family a.194.1.1: L27 domain [101289] (6 protein domains)
  6. 2014552Protein Maguk p55 subfamily member 5, Patj [101292] (2 species)
  7. 2014553Species Human (Homo sapiens) [TaxId:9606] [140707] (1 PDB entry)
    Uniprot Q8N3R9 118-177
  8. 2014554Domain d1y76b1: 1y76 B:80-139 [122684]
    Other proteins in same PDB: d1y76a1, d1y76c_

Details for d1y76b1

PDB Entry: 1y76 (more details)

PDB Description: Solution Structure of Patj/Pals1 L27 Domain Complex
PDB Compounds: (B:) MAGUK p55 subfamily member 5

SCOPe Domain Sequences for d1y76b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y76b1 a.194.1.1 (B:80-139) Maguk p55 subfamily member 5, Patj {Human (Homo sapiens) [TaxId: 9606]}
avkileiedlfsslkhiqhtlvdsqsqedislllqlvqnkdfqnafkihnaitvhmnkas

SCOPe Domain Coordinates for d1y76b1:

Click to download the PDB-style file with coordinates for d1y76b1.
(The format of our PDB-style files is described here.)

Timeline for d1y76b1: