![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
![]() | Superfamily a.194.1: L27 domain [101288] (1 family) ![]() |
![]() | Family a.194.1.1: L27 domain [101289] (6 proteins) |
![]() | Protein Associated tight junction protein Pals-1 [101290] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [140706] (1 PDB entry) Uniprot Q63ZW7 4-65 identical sequence to mouse domain |
![]() | Domain d1y76a1: 1y76 A:4-65 [122683] Other proteins in same PDB: d1y76b1, d1y76d_ |
PDB Entry: 1y76 (more details)
SCOPe Domain Sequences for d1y76a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y76a1 a.194.1.1 (A:4-65) Associated tight junction protein Pals-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq ls
Timeline for d1y76a1: