Lineage for d1y74d1 (1y74 D:83-132)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650912Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 650913Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 650914Family a.194.1.1: L27 domain [101289] (5 proteins)
  6. 650935Protein Peripheral plasma membrane protein cask [101296] (2 species)
  7. 650936Species Human (Homo sapiens) [TaxId:9606] [140708] (2 PDB entries)
  8. 650939Domain d1y74d1: 1y74 D:83-132 [122682]
    Other proteins in same PDB: d1y74a1, d1y74c1
    automatically matched to 1ZL8 B:106-159

Details for d1y74d1

PDB Entry: 1y74 (more details)

PDB Description: Solution Structure of mLin-2/mLin-7 L27 Domain Complex
PDB Compounds: (D:) Peripheral plasma membrane protein CASK

SCOP Domain Sequences for d1y74d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y74d1 a.194.1.1 (D:83-132) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]}
avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd

SCOP Domain Coordinates for d1y74d1:

Click to download the PDB-style file with coordinates for d1y74d1.
(The format of our PDB-style files is described here.)

Timeline for d1y74d1: