Lineage for d1y74c_ (1y74 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018595Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2018596Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2018597Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. 2018605Protein Lin-7 [140709] (2 species)
  7. 2018606Species Mouse (Mus musculus) [TaxId:10090] [140710] (1 PDB entry)
    Uniprot O88951 8-64
    homolog B
  8. 2018608Domain d1y74c_: 1y74 C: [122681]
    Other proteins in same PDB: d1y74b_, d1y74d_
    automated match to d1y74a1

Details for d1y74c_

PDB Entry: 1y74 (more details)

PDB Description: solution structure of mlin-2/mlin-7 l27 domain complex
PDB Compounds: (C:) lin 7 homolog b

SCOPe Domain Sequences for d1y74c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y74c_ a.194.1.1 (C:) Lin-7 {Mouse (Mus musculus) [TaxId: 10090]}
lglerdvsravellerlqrsgelppqklqalqrvlqsrfcsairevyeqlydtldit

SCOPe Domain Coordinates for d1y74c_:

Click to download the PDB-style file with coordinates for d1y74c_.
(The format of our PDB-style files is described here.)

Timeline for d1y74c_: