Lineage for d1y74b_ (1y74 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349329Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2349330Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2349331Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. 2349362Protein automated matches [254455] (1 species)
    not a true protein
  7. 2349363Species Mouse (Mus musculus) [TaxId:10090] [254970] (1 PDB entry)
  8. 2349364Domain d1y74b_: 1y74 B: [122680]
    Other proteins in same PDB: d1y74a1, d1y74c_
    automated match to d1zl8b1

Details for d1y74b_

PDB Entry: 1y74 (more details)

PDB Description: solution structure of mlin-2/mlin-7 l27 domain complex
PDB Compounds: (B:) Peripheral plasma membrane protein CASK

SCOPe Domain Sequences for d1y74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y74b_ a.194.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd

SCOPe Domain Coordinates for d1y74b_:

Click to download the PDB-style file with coordinates for d1y74b_.
(The format of our PDB-style files is described here.)

Timeline for d1y74b_: