![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
![]() | Superfamily a.194.1: L27 domain [101288] (1 family) ![]() |
![]() | Family a.194.1.1: L27 domain [101289] (6 proteins) |
![]() | Protein automated matches [254455] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [254970] (1 PDB entry) |
![]() | Domain d1y74b_: 1y74 B: [122680] Other proteins in same PDB: d1y74a1, d1y74c_ automated match to d1zl8b1 |
PDB Entry: 1y74 (more details)
SCOPe Domain Sequences for d1y74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y74b_ a.194.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd
Timeline for d1y74b_: