| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
Superfamily a.194.1: L27 domain [101288] (1 family) ![]() |
| Family a.194.1.1: L27 domain [101289] (5 proteins) |
| Protein Peripheral plasma membrane protein cask [101296] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140708] (2 PDB entries) |
| Domain d1y74b1: 1y74 B:83-132 [122680] Other proteins in same PDB: d1y74a1, d1y74c1 automatically matched to 1ZL8 B:106-159 |
PDB Entry: 1y74 (more details)
SCOP Domain Sequences for d1y74b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y74b1 a.194.1.1 (B:83-132) Peripheral plasma membrane protein cask {Human (Homo sapiens) [TaxId: 9606]}
avqrakevleeiscypenndakelkriltqphfmallqthdvvahevysd
Timeline for d1y74b1: