Lineage for d1y74a1 (1y74 A:17-73)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014536Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2014537Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2014538Family a.194.1.1: L27 domain [101289] (6 protein domains)
  6. 2014546Protein Lin-7 [140709] (2 species)
  7. 2014547Species Mouse (Mus musculus) [TaxId:10090] [140710] (1 PDB entry)
    Uniprot O88951 8-64
    homolog B
  8. 2014548Domain d1y74a1: 1y74 A:17-73 [122679]
    Other proteins in same PDB: d1y74b_, d1y74d_

Details for d1y74a1

PDB Entry: 1y74 (more details)

PDB Description: Solution Structure of mLin-2/mLin-7 L27 Domain Complex
PDB Compounds: (A:) lin 7 homolog b

SCOPe Domain Sequences for d1y74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y74a1 a.194.1.1 (A:17-73) Lin-7 {Mouse (Mus musculus) [TaxId: 10090]}
lglerdvsravellerlqrsgelppqklqalqrvlqsrfcsairevyeqlydtldit

SCOPe Domain Coordinates for d1y74a1:

Click to download the PDB-style file with coordinates for d1y74a1.
(The format of our PDB-style files is described here.)

Timeline for d1y74a1: