SCOPe 2.07: Domain d1y6xa1: 1y6x A:7-93

Lineage for d1y6xa1 (1y6x A:7-93)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
   Pfam PF01503

6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140801] (1 PDB entry)
   Uniprot O33257 7-93

8. Domain d1y6xa1: 1y6x A:7-93 [122676]

Details for d1y6xa1

PDB Entry: 1y6x, 1.25 Å

PDB Description: The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis

PDB Compounds: (A:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d1y6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1y6xa1 a.204.1.4 (A:7-93) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis [TaxId: 1773]}
vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
eisqllywtqvlmisrglslddvyrkl

Timeline for d1y6xa1:

• d1y6xa1 first appeared in SCOP 1.73
  
• d1y6xa1 appears in SCOPe 2.06
  
• d1y6xa1 appears in the current release, SCOPe 2.08