Lineage for d1y6xa1 (1y6x A:7-93)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651014Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 651015Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 651055Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 651056Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (4 species)
  7. 651075Species Mycobacterium tuberculosis [TaxId:1773] [140801] (1 PDB entry)
  8. 651076Domain d1y6xa1: 1y6x A:7-93 [122676]

Details for d1y6xa1

PDB Entry: 1y6x (more details), 1.25 Å

PDB Description: The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
PDB Compounds: (A:) Phosphoribosyl-ATP pyrophosphatase

SCOP Domain Sequences for d1y6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6xa1 a.204.1.4 (A:7-93) Phosphoribosyl-ATP pyrophosphatase HisE {Mycobacterium tuberculosis [TaxId: 1773]}
vktfedlfaelgdrartrpadsttvaaldggvhalgkklleeagevwlaaehesndalae
eisqllywtqvlmisrglslddvyrkl

SCOP Domain Coordinates for d1y6xa1:

Click to download the PDB-style file with coordinates for d1y6xa1.
(The format of our PDB-style files is described here.)

Timeline for d1y6xa1: