SCOP 1.75: Domain d1y6nr2: 1y6n R:101-203

Lineage for d1y6nr2 (1y6n R:101-203)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries)

8. Domain d1y6nr2: 1y6n R:101-203 [122669]
   Other proteins in same PDB: d1y6nl1
   automatically matched to d1lqsr2
   mutant

Details for d1y6nr2

PDB Entry: 1y6n, 2.7 Å

PDB Description: crystal structure of epstein-barr virus il-10 mutant (a87i) complexed with the soluble il-10r1 chain

PDB Compounds: (R:) interleukin-10 receptor alpha chain

SCOP Domain Sequences for d1y6nr2:

Sequence; same for both SEQRES and ATOM records:

>d1y6nr2 b.1.2.1 (R:101-203) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftft
hkkvkheqfslltsgevgefcvqvkpsvasrsnkgmwskeeci

Timeline for d1y6nr2:

• d1y6nr2 first appeared in SCOP 1.73
  
• d1y6nr2 appears in SCOPe 2.01
  
• d1y6nr2 appears in the current release, SCOPe 2.08