Lineage for d1y6nr1 (1y6n R:2-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762004Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)
  7. 2762005Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries)
  8. 2762008Domain d1y6nr1: 1y6n R:2-100 [122668]
    Other proteins in same PDB: d1y6nl1
    automated match to d1lqsr1
    mutant

Details for d1y6nr1

PDB Entry: 1y6n (more details), 2.7 Å

PDB Description: crystal structure of epstein-barr virus il-10 mutant (a87i) complexed with the soluble il-10r1 chain
PDB Compounds: (R:) interleukin-10 receptor alpha chain

SCOPe Domain Sequences for d1y6nr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6nr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

SCOPe Domain Coordinates for d1y6nr1:

Click to download the PDB-style file with coordinates for d1y6nr1.
(The format of our PDB-style files is described here.)

Timeline for d1y6nr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6nr2
View in 3D
Domains from other chains:
(mouse over for more information)
d1y6nl1