| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries) |
| Domain d1y6nr1: 1y6n R:2-100 [122668] Other proteins in same PDB: d1y6nl1 automated match to d1lqsr1 mutant |
PDB Entry: 1y6n (more details), 2.7 Å
SCOPe Domain Sequences for d1y6nr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6nr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd
Timeline for d1y6nr1: