SCOPe 2.08: Domain d1y6mr1: 1y6m R:3-100

Lineage for d1y6mr1 (1y6m R:3-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries)

8. Domain d1y6mr1: 1y6m R:3-100 [122666]
   Other proteins in same PDB: d1y6ml_
   automated match to d1lqsr1

Details for d1y6mr1

PDB Entry: 1y6m, 2.8 Å

PDB Description: crystal structure of epstein-barr virus il-10 complexed with the soluble il-10r1 chain

PDB Compounds: (R:) interleukin-10 receptor alpha chain

SCOPe Domain Sequences for d1y6mr1:

Sequence; same for both SEQRES and ATOM records:

>d1y6mr1 b.1.2.1 (R:3-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]}
telpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsydl
tavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

Timeline for d1y6mr1:

• d1y6mr1 first appeared in SCOP 1.73
  
• d1y6mr1 appears in SCOPe 2.07