Lineage for d1y6ml_ (1y6m L:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705853Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
    intertwined dimer, similar to interferon-gamma
  7. 2705854Species Epstein-Barr virus [TaxId:10376] [47308] (3 PDB entries)
  8. 2705857Domain d1y6ml_: 1y6m L: [122665]
    Other proteins in same PDB: d1y6mr1, d1y6mr2
    automated match to d1vlk__

Details for d1y6ml_

PDB Entry: 1y6m (more details), 2.8 Å

PDB Description: crystal structure of epstein-barr virus il-10 complexed with the soluble il-10r1 chain
PDB Compounds: (L:) Viral interleukin-10 homolog

SCOPe Domain Sequences for d1y6ml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6ml_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus [TaxId: 10376]}
cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
iykamsefdifinyieaymtik

SCOPe Domain Coordinates for d1y6ml_:

Click to download the PDB-style file with coordinates for d1y6ml_.
(The format of our PDB-style files is described here.)

Timeline for d1y6ml_: