SCOPe 2.07: Domain d1y6kl_: 1y6k L:

Lineage for d1y6kl_ (1y6k L:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human (Homo sapiens) [TaxId:9606] [47307] (6 PDB entries)

8. Domain d1y6kl_: 1y6k L: [122662]
   Other proteins in same PDB: d1y6kr1, d1y6kr2
   automated match to d2ilk__

Details for d1y6kl_

PDB Entry: 1y6k, 2.52 Å

PDB Description: crystal structure of human il-10 complexed with the soluble il-10r1 chain

PDB Compounds: (L:) interleukin-10

SCOPe Domain Sequences for d1y6kl_:

Sequence; same for both SEQRES and ATOM records:

>d1y6kl_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
cthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqf
yleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnkl
qekgiykamsefdifinyieaymtm

Timeline for d1y6kl_:

• d1y6kl_ first appeared in SCOP 1.73, called d1y6kl1
  
• d1y6kl_ appears in SCOPe 2.06
  
• d1y6kl_ appears in the current release, SCOPe 2.08