Lineage for d1y6kl1 (1y6k L:12-156)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 639437Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 639600Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 639648Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
    intertwined dimer, similar to interferon-gamma
  7. 639652Species Human (Homo sapiens) [TaxId:9606] [47307] (7 PDB entries)
  8. 639659Domain d1y6kl1: 1y6k L:12-156 [122662]
    Other proteins in same PDB: d1y6kr1, d1y6kr2
    automatically matched to d2ilk__
    mutant

Details for d1y6kl1

PDB Entry: 1y6k (more details), 2.52 Å

PDB Description: Crystal structure of human IL-10 complexed with the soluble IL-10R1 chain
PDB Compounds: (L:) interleukin-10

SCOP Domain Sequences for d1y6kl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6kl1 a.26.1.3 (L:12-156) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
cthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqf
yleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnkl
qekgiykamsefdifinyieaymtm

SCOP Domain Coordinates for d1y6kl1:

Click to download the PDB-style file with coordinates for d1y6kl1.
(The format of our PDB-style files is described here.)

Timeline for d1y6kl1: