Lineage for d1y6kl_ (1y6k L:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705853Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
    intertwined dimer, similar to interferon-gamma
  7. 2705858Species Human (Homo sapiens) [TaxId:9606] [47307] (6 PDB entries)
  8. 2705864Domain d1y6kl_: 1y6k L: [122662]
    Other proteins in same PDB: d1y6kr1, d1y6kr2
    automated match to d2ilk__

Details for d1y6kl_

PDB Entry: 1y6k (more details), 2.52 Å

PDB Description: crystal structure of human il-10 complexed with the soluble il-10r1 chain
PDB Compounds: (L:) interleukin-10

SCOPe Domain Sequences for d1y6kl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6kl_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
cthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqf
yleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnkl
qekgiykamsefdifinyieaymtm

SCOPe Domain Coordinates for d1y6kl_:

Click to download the PDB-style file with coordinates for d1y6kl_.
(The format of our PDB-style files is described here.)

Timeline for d1y6kl_: