Lineage for d1y6ia2 (1y6i A:83-233)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016241Fold a.261: GUN4-like [140868] (1 superfamily)
    multihelical; open array, trapping inside an extended region before the C-terminal helix
  4. 2016242Superfamily a.261.1: GUN4-like [140869] (1 family) (S)
    automatically mapped to Pfam PF05419
  5. 2016243Family a.261.1.1: GUN4-like [140870] (2 protein domains)
    Pfam PF05419
  6. 2016248Protein Mg-chelatase cofactor Gun4 [140871] (2 species)
    Ycf53-like protein sll0558
  7. 2016249Species Synechocystis sp. PCC 6803 [TaxId:1148] [140872] (1 PDB entry)
    Uniprot P72583 83-233
  8. 2016250Domain d1y6ia2: 1y6i A:83-233 [122661]
    Other proteins in same PDB: d1y6ia1

Details for d1y6ia2

PDB Entry: 1y6i (more details), 1.78 Å

PDB Description: Synechocystis GUN4
PDB Compounds: (A:) Mg-chelatase cofactor GUN4

SCOPe Domain Sequences for d1y6ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6ia2 a.261.1.1 (A:83-233) Mg-chelatase cofactor Gun4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
fplqsaqgidylplqealgsqdfetadeitrdklcelagpgasqrqwlyftevekfpald
lhtinalwwlhsngnfgfsvqrrlwlasgkeftklwpkigwksgnvwtrwpkgftwdlsa
pqghlpllnqlrgvrvaeslyrhpvwsqygw

SCOPe Domain Coordinates for d1y6ia2:

Click to download the PDB-style file with coordinates for d1y6ia2.
(The format of our PDB-style files is described here.)

Timeline for d1y6ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6ia1